Summary

NP_013143.1

Homolog: XP_682342.1.
Wiesman et al.[1]:

Statistics

Total Homologs: 141
Non significant structural homologs: 131
Total Synteny Homologs: 0
Found Synteny Homologs: 0
Synteny Status: No synteny homologs exists

Structures and Sequence Alignment

The best structural homolog was XP_682342.1 (XP_682342.1 hypothetical protein AN9073.2 [Aspergillus nidulans FGSC A4]) with a FATCAT [2] P-Value: 1.21e-02 and RMSD of 2.83 angstrom. The sequence alignment identity is 23.0%.
Structural alignment shown in left. Query protein NP_013143.1 colored as red in alignment, homolog XP_682342.1 colored as blue. Query protein NP_013143.1 is also shown in right top, homolog XP_682342.1 showed in right bottom. They are colored based on secondary structures.

  NP_013143.1 MKISQFGSLAFAPIVLLQLFIVQAQLLTDSNAQDLNTALGQKVQYTFLDTGNSNDQLLHLPSTTSSSIITGSLAAAN----FTGSSSSSSIPKVTSS-VI 95
  XP_682342.1 -------------MQLLKTILLFSAAFTPAFAAVANGGSGETESFT--STRTTTVTVTVKTSTTATPTPTYTPTSTSTPVIVTPSSTATPTPSPCSSFVI 85

  NP_013143.1 TSINYQSSNSTVVTQFTPLPSSSRNETKS-SQTTNTISSSTS-TGGVGSVKPCLYF----VL--MLETIAYLFS 161
  XP_682342.1 TKIH----SSTIAPSYA--PSSAS--TGGFASGSSTVSASPSQTPFTGAAVPGAKFSGAGVVGAGLAAMAFLL- 150

Homologs

Homolog Description FATCAT p-val FATCAT RMSD PROST Evalue Synteny Sequence Identity
XP_662416.1 XP_662416.1 hypothetical protein AN4812.2 [Aspergillus nidulans FGSC A4] 9.52e-02 3.31 6.94e-28 False 26.61%
Kwal_24665 Kwal_24665 4.65e-01 3.83 1.09e-25 False 28.97%
NP_588009.1 NP_588009.1 uncharacterized protein SPCC24B10.06 [Schizosaccharomyces pombe] 1.68e-02 2.86 3.51e-25 False 24.86%
XP_003673348.1 XP_003673348.1 hypothetical protein NCAS_0A04030 [Naumovozyma castellii CBS 4309] 4.38e-02 2.90 7.71e-24 False 30.29%
XP_662483.1 XP_662483.1 hypothetical protein AN4879.2 [Aspergillus nidulans FGSC A4] 1.55e-02 2.45 1.08e-21 False 24.30%
Kwal_17840 Kwal_17840 6.53e-02 2.66 1.91e-21 False 25.62%
NP_982642.1 NP_982642.1 AAR101Wp [Eremothecium gossypii ATCC 10895] 2.17e-02 3.32 1.11e-20 False 24.04%
XP_503520.1 XP_503520.1 YALI0E03938p [Yarrowia lipolytica CLIB122] 4.91e-02 2.93 4.78e-20 False 24.61%
XP_658764.1 XP_658764.1 hypothetical protein AN1160.2 [Aspergillus nidulans FGSC A4] 1.37e-01 3.46 1.59e-19 False 25.95%
XP_501110.2 XP_501110.2 YALI0B19778p [Yarrowia lipolytica CLIB122] 5.67e-02 3.14 2.64e-18 False 20.59%
Kwal_5310 Kwal_5310 2.41e-01 2.55 2.73e-18 False 24.44%
XP_454836.1 XP_454836.1 uncharacterized protein KLLA0_E19559g [Kluyveromyces lactis] 5.05e-02 3.56 1.04e-17 False 27.65%
XP_452420.1 XP_452420.1 uncharacterized protein KLLA0_C04928g [Kluyveromyces lactis] 4.84e-01 3.56 4.61e-17 False 29.17%
XP_663438.1 XP_663438.1 hypothetical protein AN5834.2 [Aspergillus nidulans FGSC A4] 2.01e-01 3.27 1.11e-16 False 22.99%
XP_451325.1 XP_451325.1 uncharacterized protein KLLA0_A07315g [Kluyveromyces lactis] 2.65e-01 2.57 1.48e-16 False 22.42%
NP_986714.1 NP_986714.1 AGR049Wp [Eremothecium gossypii ATCC 10895] 4.66e-01 2.90 3.77e-16 False 23.70%
XP_682342.1 XP_682342.1 hypothetical protein AN9073.2 [Aspergillus nidulans FGSC A4] 1.21e-02 2.83 4.34e-16 False 22.99%
XP_452424.1 XP_452424.1 uncharacterized protein KLLA0_C05016g [Kluyveromyces lactis] 3.75e-01 3.07 1.14e-15 False 27.42%
XP_680923.1 XP_680923.1 hypothetical protein AN7654.2 [Aspergillus nidulans FGSC A4] 1.92e-01 3.83 2.81e-15 False 17.49%
XP_661985.1 XP_661985.1 hypothetical protein AN4381.2 [Aspergillus nidulans FGSC A4] 2.36e-01 3.16 3.27e-15 False 24.75%
XP_500092.1 XP_500092.1 YALI0A15378p [Yarrowia lipolytica CLIB122] 9.41e-02 3.65 3.99e-15 False 20.00%
NP_982617.1 NP_982617.1 AAR076Cp [Eremothecium gossypii ATCC 10895] 2.19e-01 3.07 3.99e-15 False 20.35%
XP_505400.1 XP_505400.1 YALI0F14157p [Yarrowia lipolytica CLIB122] 2.73e-01 4.07 8.18e-15 False 22.22%
XP_662894.1 XP_662894.1 hypothetical protein AN5290.2 [Aspergillus nidulans FGSC A4] 5.81e-01 3.03 9.81e-15 False 23.59%
XP_661794.1 XP_661794.1 hypothetical protein AN4190.2 [Aspergillus nidulans FGSC A4] 7.96e-02 2.79 1.03e-14 False 25.00%
XP_660049.1 XP_660049.1 hypothetical protein AN2445.2 [Aspergillus nidulans FGSC A4] 5.97e-01 5.21 1.25e-14 False 21.28%
XP_003676711.1 XP_003676711.1 hypothetical protein NCAS_0E02820 [Naumovozyma castellii CBS 4309] 3.79e-01 4.14 1.37e-14 False 16.61%
XP_451189.1 XP_451189.1 uncharacterized protein KLLA0_A04323g [Kluyveromyces lactis] 6.00e-01 2.67 1.39e-14 False 23.58%
XP_500900.1 XP_500900.1 YALI0B14795p [Yarrowia lipolytica CLIB122] 1.48e-01 6.27 1.93e-14 False 24.72%
XP_003673937.1 XP_003673937.1 hypothetical protein NCAS_0A09980 [Naumovozyma castellii CBS 4309] 1.86e-01 3.73 3.63e-14 False 23.84%
XP_499904.2 XP_499904.2 YALI0A09471p [Yarrowia lipolytica CLIB122] 5.40e-02 5.17 4.15e-14 False 28.02%
XP_664770.1 XP_664770.1 hypothetical protein AN7166.2 [Aspergillus nidulans FGSC A4] 2.13e-01 3.62 5.10e-14 False 24.45%
XP_659136.1 XP_659136.1 hypothetical protein AN1532.2 [Aspergillus nidulans FGSC A4] 5.36e-01 3.13 5.26e-14 False 23.47%
XP_003678164.1 XP_003678164.1 hypothetical protein NCAS_0I01540 [Naumovozyma castellii CBS 4309] 1.62e-01 3.12 7.07e-14 False 20.16%
NP_984918.2 NP_984918.2 AER058Wp [Eremothecium gossypii ATCC 10895] 4.78e-01 3.74 9.36e-14 False 18.65%
XP_003678466.1 XP_003678466.1 hypothetical protein NCAS_0J01490 [Naumovozyma castellii CBS 4309] 6.51e-01 3.37 3.53e-13 False 26.79%
XP_682182.1 XP_682182.1 hypothetical protein AN8913.2 [Aspergillus nidulans FGSC A4] 1.54e-01 2.71 7.26e-13 False 23.39%
XP_451191.1 XP_451191.1 uncharacterized protein KLLA0_A04367g [Kluyveromyces lactis] 5.19e-01 3.23 8.26e-13 False 29.29%
XP_661008.1 XP_661008.1 predicted protein [Aspergillus nidulans FGSC A4] 2.67e-01 2.57 1.02e-12 False 21.27%
Kwal_23626 Kwal_23626 2.79e-01 3.05 1.78e-12 False 20.56%
XP_003675694.1 XP_003675694.1 hypothetical protein NCAS_0C03390 [Naumovozyma castellii CBS 4309] 1.88e-01 2.49 2.11e-12 False 25.15%
XP_003678082.1 XP_003678082.1 hypothetical protein NCAS_0I00690 [Naumovozyma castellii CBS 4309] 3.49e-01 3.76 3.98e-12 False 23.88%
XP_660819.1 XP_660819.1 predicted protein [Aspergillus nidulans FGSC A4] 1.24e-01 2.40 4.15e-12 False 25.98%
NP_985612.2 NP_985612.2 AFR065Wp [Eremothecium gossypii ATCC 10895] 2.60e-01 2.89 6.57e-12 False 23.41%
XP_003676639.1 XP_003676639.1 hypothetical protein NCAS_0E02100 [Naumovozyma castellii CBS 4309] 5.01e-01 3.96 7.05e-12 False 26.89%
XP_453996.1 XP_453996.1 uncharacterized protein KLLA0_E01057g [Kluyveromyces lactis] 6.63e-01 4.81 7.66e-12 False 24.12%
XP_501182.1 XP_501182.1 YALI0B21450p [Yarrowia lipolytica CLIB122] 1.35e-01 2.51 1.43e-11 False 23.76%
XP_455871.1 XP_455871.1 uncharacterized protein KLLA0_F17611g [Kluyveromyces lactis] 1.53e-01 3.30 1.93e-11 False 21.13%
XP_003674804.1 XP_003674804.1 hypothetical protein NCAS_0B03460 [Naumovozyma castellii CBS 4309] 3.89e-01 3.05 2.90e-11 False 26.53%
XP_663366.1 XP_663366.1 hypothetical protein AN5762.2 [Aspergillus nidulans FGSC A4] 2.70e-01 2.57 6.28e-11 False 30.41%
XP_501836.1 XP_501836.1 YALI0C14630p [Yarrowia lipolytica CLIB122] 3.21e-02 3.45 6.90e-11 False 23.55%
XP_455980.1 XP_455980.1 uncharacterized protein KLLA0_F20031g [Kluyveromyces lactis] 2.63e-01 2.91 7.89e-11 False 21.67%
XP_505709.1 XP_505709.1 YALI0F21428p [Yarrowia lipolytica CLIB122] 4.29e-01 3.90 8.32e-11 False 22.88%
XP_455852.1 XP_455852.1 uncharacterized protein KLLA0_F17182g [Kluyveromyces lactis] 2.28e-01 4.46 1.40e-10 False 25.89%
XP_505768.1 XP_505768.1 YALI0F22847p [Yarrowia lipolytica CLIB122] 3.08e-02 2.49 1.48e-10 False 22.37%
XP_659094.1 XP_659094.1 hypothetical protein AN1490.2 [Aspergillus nidulans FGSC A4] 6.65e-01 3.57 2.64e-10 False 18.49%
XP_868832.1 XP_868832.1 hypothetical protein AN9450.2 [Aspergillus nidulans FGSC A4] 2.26e-01 2.78 4.01e-10 False 24.65%
XP_003678079.1 XP_003678079.1 hypothetical protein NCAS_0I00660 [Naumovozyma castellii CBS 4309] 2.35e-01 3.00 7.20e-10 False 21.32%
Kwal_14692 Kwal_14692 5.36e-01 5.46 1.17e-09 False 17.65%
XP_680592.1 XP_680592.1 hypothetical protein AN7323.2 [Aspergillus nidulans FGSC A4] 2.78e-01 2.92 1.29e-09 False 25.23%
XP_003673255.1 XP_003673255.1 hypothetical protein NCAS_0A03060 [Naumovozyma castellii CBS 4309] 7.42e-01 2.78 2.86e-09 False 10.29%
XP_661275.1 XP_661275.1 hypothetical protein AN3671.2 [Aspergillus nidulans FGSC A4] 5.00e-01 2.56 3.13e-09 False 17.11%
XP_003673349.1 XP_003673349.1 hypothetical protein NCAS_0A04040 [Naumovozyma castellii CBS 4309] 3.65e-01 3.57 3.88e-09 False 19.41%
XP_503352.1 XP_503352.1 YALI0D27214p [Yarrowia lipolytica CLIB122] 6.60e-01 3.30 1.10e-08 False 23.05%
XP_502228.1 XP_502228.1 YALI0D00154p [Yarrowia lipolytica CLIB122] 1.68e-01 2.88 1.13e-08 False 24.54%
XP_660306.1 XP_660306.1 hypothetical protein AN2702.2 [Aspergillus nidulans FGSC A4] 1.78e-01 3.30 1.29e-08 False 20.87%
XP_659165.1 XP_659165.1 hypothetical protein AN1561.2 [Aspergillus nidulans FGSC A4] 6.02e-01 3.12 2.19e-08 False 23.28%
XP_003674507.1 XP_003674507.1 hypothetical protein NCAS_0B00460 [Naumovozyma castellii CBS 4309] 3.28e-01 2.69 2.36e-08 False 17.76%
XP_658942.1 XP_658942.1 hypothetical protein AN1338.2 [Aspergillus nidulans FGSC A4] 2.14e-01 3.31 2.60e-08 False 26.37%
XP_505913.1 XP_505913.1 YALI0F26565p [Yarrowia lipolytica CLIB122] 1.31e-01 2.66 2.60e-08 False 14.00%
XP_661958.1 XP_661958.1 hypothetical protein AN4354.2 [Aspergillus nidulans FGSC A4] 1.60e-01 2.96 3.87e-08 False 23.97%
XP_504256.1 XP_504256.1 YALI0E22088p [Yarrowia lipolytica CLIB122] 4.78e-01 3.17 7.48e-08 False 17.63%
XP_659231.1 XP_659231.1 hypothetical protein AN1627.2 [Aspergillus nidulans FGSC A4] 3.48e-01 4.19 7.75e-08 False 26.73%
XP_504502.1 XP_504502.1 YALI0E28336p [Yarrowia lipolytica CLIB122] 3.45e-01 2.78 8.23e-08 False 13.37%
Kwal_7812 Kwal_7812 7.25e-01 3.50 1.07e-07 False 20.82%
XP_681878.1 XP_681878.1 hypothetical protein AN8609.2 [Aspergillus nidulans FGSC A4] 1.30e-01 2.04 1.77e-07 False 22.27%
XP_455870.1 XP_455870.1 uncharacterized protein KLLA0_F17589g [Kluyveromyces lactis] 9.55e-02 2.66 1.92e-07 False 24.76%
NP_596170.1 NP_596170.1 uncharacterized protein SPBP19A11.02c [Schizosaccharomyces pombe] 3.45e-01 2.99 2.40e-07 False 16.43%
XP_504119.1 XP_504119.1 YALI0E18788p [Yarrowia lipolytica CLIB122] 5.39e-01 3.48 2.79e-07 False 20.17%
XP_661864.1 XP_661864.1 hypothetical protein AN4260.2 [Aspergillus nidulans FGSC A4] 2.82e-01 2.41 3.85e-07 False 23.68%
NP_587764.1 NP_587764.1 uncharacterized protein SPCC553.10 [Schizosaccharomyces pombe] 5.87e-01 3.33 4.37e-07 False 13.17%
XP_664358.1 XP_664358.1 hypothetical protein AN6754.2 [Aspergillus nidulans FGSC A4] 7.38e-01 3.57 5.37e-07 False 25.97%
XP_659053.1 XP_659053.1 hypothetical protein AN1449.2 [Aspergillus nidulans FGSC A4] 5.21e-01 3.15 5.89e-07 False 23.97%
XP_504901.1 XP_504901.1 YALI0F02343p [Yarrowia lipolytica CLIB122] 6.64e-01 3.21 8.47e-07 False 20.39%
XP_454170.1 XP_454170.1 uncharacterized protein KLLA0_E04995g [Kluyveromyces lactis] 4.17e-01 2.71 9.70e-07 False 22.92%
XP_451190.1 XP_451190.1 uncharacterized protein KLLA0_A04345g [Kluyveromyces lactis] 3.15e-01 2.43 1.00e-06 False 15.89%
XP_503907.1 XP_503907.1 YALI0E13574p [Yarrowia lipolytica CLIB122] 6.80e-01 3.01 1.04e-06 False 13.16%
XP_501953.1 XP_501953.1 YALI0C17875p [Yarrowia lipolytica CLIB122] 4.46e-01 4.38 1.05e-06 False 16.73%
NP_588138.1 NP_588138.1 cell wall protein Pwp1 [Schizosaccharomyces pombe] 5.01e-01 2.60 2.01e-06 False 23.90%
NP_984115.1 NP_984115.1 ADR019Cp [Eremothecium gossypii ATCC 10895] 8.83e-02 2.42 2.08e-06 False 24.78%
XP_504201.1 XP_504201.1 YALI0E20757p [Yarrowia lipolytica CLIB122] 5.19e-01 2.50 2.48e-06 False 15.81%
NP_595802.1 NP_595802.1 uncharacterized protein SPBC1E8.05 [Schizosaccharomyces pombe] 7.52e-01 3.23 2.80e-06 False 19.21%
XP_455075.1 XP_455075.1 uncharacterized protein KLLA0_E24927g [Kluyveromyces lactis] 5.67e-01 3.02 4.39e-06 False 19.22%
XP_501892.1 XP_501892.1 YALI0C16148p [Yarrowia lipolytica CLIB122] 2.58e-01 3.28 5.34e-06 False 12.02%
NP_594922.1 NP_594922.1 protein adg1 [Schizosaccharomyces pombe] 1.08e-01 3.16 5.46e-06 False 21.16%
XP_502608.1 XP_502608.1 YALI0D09185p [Yarrowia lipolytica CLIB122] 1.89e-01 3.16 6.28e-06 False 14.81%
XP_003673662.1 XP_003673662.1 hypothetical protein NCAS_0A07230 [Naumovozyma castellii CBS 4309] 1.69e-01 3.96 8.14e-06 False 18.07%
XP_505123.1 XP_505123.1 YALI0F07535p [Yarrowia lipolytica CLIB122] 1.41e-01 2.46 8.41e-06 False 14.33%
XP_504412.1 XP_504412.1 YALI0E26125p [Yarrowia lipolytica CLIB122] 6.26e-01 3.24 9.36e-06 False 19.18%
XP_501063.1 XP_501063.1 YALI0B18568p [Yarrowia lipolytica CLIB122] 6.67e-01 2.98 9.36e-06 False 7.64%
XP_002143049.1 XP_002143049.1 YALI0D07535p [Yarrowia lipolytica CLIB122] 8.18e-02 2.85 1.10e-05 False 24.85%
XP_503406.1 XP_503406.1 YALI0E01210p [Yarrowia lipolytica CLIB122] 2.67e-01 3.73 1.13e-05 False 13.46%
XP_662961.1 XP_662961.1 hypothetical protein AN5357.2 [Aspergillus nidulans FGSC A4] 6.89e-01 3.19 1.30e-05 False 22.01%
XP_659097.1 XP_659097.1 hypothetical protein AN1493.2 [Aspergillus nidulans FGSC A4] 2.11e-01 5.29 1.58e-05 False 26.61%
XP_659545.1 XP_659545.1 hypothetical protein AN1941.2 [Aspergillus nidulans FGSC A4] 6.19e-01 3.35 1.73e-05 False 24.04%
XP_504268.1 XP_504268.1 YALI0E22440p [Yarrowia lipolytica CLIB122] 2.13e-01 3.66 1.73e-05 False 19.08%
XP_003676920.1 XP_003676920.1 hypothetical protein NCAS_0F00800 [Naumovozyma castellii CBS 4309] 2.86e-01 3.74 1.95e-05 False 20.91%
Kwal_4220 Kwal_4220 7.42e-01 3.22 2.43e-05 False 14.88%
NP_001342227.1 NP_001342227.1 AFR725C-Ap [Eremothecium gossypii ATCC 10895] 2.81e-01 3.18 2.99e-05 False 13.77%
XP_664075.1 XP_664075.1 hypothetical protein AN6471.2 [Aspergillus nidulans FGSC A4] 5.45e-01 3.46 3.57e-05 False 22.77%
XP_503823.1 XP_503823.1 YALI0E11517p [Yarrowia lipolytica CLIB122] 6.12e-01 4.14 4.53e-05 False 20.58%
XP_680596.1 XP_680596.1 hypothetical protein AN7327.2 [Aspergillus nidulans FGSC A4] 2.48e-01 3.25 5.34e-05 False 17.77%
XP_660731.1 XP_660731.1 hypothetical protein AN3127.2 [Aspergillus nidulans FGSC A4] 2.61e-01 2.96 6.90e-05 False 10.05%
XP_663014.1 XP_663014.1 predicted protein [Aspergillus nidulans FGSC A4] 7.03e-01 2.78 8.37e-05 False 23.18%
XP_501042.1 XP_501042.1 YALI0B18084p [Yarrowia lipolytica CLIB122] 7.79e-02 4.19 1.01e-04 False 19.92%
XP_452252.1 XP_452252.1 uncharacterized protein KLLA0_C01276g [Kluyveromyces lactis] 4.91e-01 3.48 1.05e-04 False 17.49%
XP_663552.1 XP_663552.1 predicted protein [Aspergillus nidulans FGSC A4] 7.02e-01 3.58 1.08e-04 False 21.03%
XP_452021.1 XP_452021.1 uncharacterized protein KLLA0_B11055g [Kluyveromyces lactis] 1.55e-01 2.55 1.27e-04 False 14.97%
XP_505668.1 XP_505668.1 YALI0F20548p [Yarrowia lipolytica CLIB122] 5.30e-02 2.56 1.29e-04 False 27.49%
XP_505571.1 XP_505571.1 YALI0F18282p [Yarrowia lipolytica CLIB122] 7.75e-01 3.85 1.40e-04 False 20.08%
XP_503675.1 XP_503675.1 YALI0E07832p [Yarrowia lipolytica CLIB122] 3.51e-01 3.18 1.52e-04 False 18.88%
Kwal_12366 Kwal_12366 7.54e-01 3.35 1.53e-04 False 27.65%
XP_452714.1 XP_452714.1 uncharacterized protein KLLA0_C11517g [Kluyveromyces lactis] 3.45e-01 2.57 1.89e-04 False 9.40%
XP_504620.1 XP_504620.1 YALI0E31108p [Yarrowia lipolytica CLIB122] 5.81e-01 3.07 1.90e-04 False 19.84%
XP_504707.1 XP_504707.1 YALI0E32967p [Yarrowia lipolytica CLIB122] 2.85e-01 3.12 1.94e-04 False 14.24%
XP_451817.1 XP_451817.1 uncharacterized protein KLLA0_B06347g [Kluyveromyces lactis] 6.25e-01 3.23 1.98e-04 False 22.59%
XP_499614.1 XP_499614.1 YALI0A00374p [Yarrowia lipolytica CLIB122] 1.44e-01 2.94 2.66e-04 False 19.47%
XP_003675353.1 XP_003675353.1 hypothetical protein NCAS_0B08990 [Naumovozyma castellii CBS 4309] 1.23e-02 1.02 3.54e-04 False 15.38%
XP_003674876.1 XP_003674876.1 hypothetical protein NCAS_0B04190 [Naumovozyma castellii CBS 4309] 6.81e-01 3.36 3.86e-04 False 17.33%
XP_661235.1 XP_661235.1 hypothetical protein AN3631.2 [Aspergillus nidulans FGSC A4] 7.45e-01 4.10 4.13e-04 False 13.98%
XP_504115.1 XP_504115.1 YALI0E18700p [Yarrowia lipolytica CLIB122] 5.60e-01 3.81 4.30e-04 False 9.57%
XP_455074.1 XP_455074.1 uncharacterized protein KLLA0_E24905g [Kluyveromyces lactis] 6.83e-01 3.63 4.38e-04 False 25.84%
NP_985576.2 NP_985576.2 AFR029Cp [Eremothecium gossypii ATCC 10895] 1.31e-01 2.88 4.78e-04 False 23.94%
XP_003672977.1 XP_003672977.1 hypothetical protein NCAS_0A00260 [Naumovozyma castellii CBS 4309] 9.21e-02 2.61 5.16e-04 False 16.87%
XP_003675980.1 XP_003675980.1 hypothetical protein NCAS_0D00350 [Naumovozyma castellii CBS 4309] 2.05e-01 2.67 5.63e-04 False 22.13%
XP_499895.1 XP_499895.1 YALI0A09196p [Yarrowia lipolytica CLIB122] 4.00e-02 1.99 5.63e-04 False 12.96%
NP_595526.2 NP_595526.2 putative transmembrane receptor Wsc1 [Schizosaccharomyces pombe] 3.10e-01 3.51 5.97e-04 False 14.75%
XP_455082.1 XP_455082.1 uncharacterized protein KLLA0_E25147g [Kluyveromyces lactis] 4.58e-01 3.53 6.08e-04 False 13.93%
XP_455072.1 XP_455072.1 uncharacterized protein KLLA0_E24861g [Kluyveromyces lactis] 7.41e-01 3.38 6.63e-04 False 20.25%
XP_680820.1 XP_680820.1 hypothetical protein AN7551.2 [Aspergillus nidulans FGSC A4] 2.90e-01 3.55 8.10e-04 False 18.41%
XP_660914.1 XP_660914.1 hypothetical protein AN3310.2 [Aspergillus nidulans FGSC A4] 6.45e-01 3.02 9.61e-04 False 28.57%